PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.E01553.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family CPP
Protein Properties Length: 565aa    MW: 61637.6 Da    PI: 8.4594
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.E01553.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR40.84.3e-13111150242
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                     +kk CnC++s+Clk+YCeCfa+g++C+  C+C++C+N+ e+
  Pahal.E01553.1 111 KKKCCNCRNSRCLKLYCECFASGAHCDG-CNCTNCFNNPEN 150
                     799*************************.********9875 PP

2TCR512.9e-16194233140
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  Pahal.E01553.1 194 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCMDCKNFE 233
                     589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.7E-13110150IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.385111234IPR005172CRC domain
PfamPF036382.8E-9112147IPR005172CRC domain
SMARTSM011148.4E-20194235IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.1E-12197232IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 565 aa     Download sequence    Send to blast
MAAAAAAVSR ALQPRTLPVG LQHPPHHARA AVPMGVPQQL HPRVLPVMRP HQVVGHVPLP  60
RHAVPVAVPV PQLRPVPPQP VQRPPVAVPL KPESPKPRLR LYEGKDSTPT KKKCCNCRNS  120
RCLKLYCECF ASGAHCDGCN CTNCFNNPEN EVARREAIDA TLERNPDAFR PKIGSSPHAN  180
RNNEVSSDLP LVGKHNKGCH CKKSGCLKKY CECFQANILC SENCKCMDCK NFEGSEERRS  240
LFQGDHKNSI NMQQVTNAAV NGAIGATGFS SPSTSRKRKH IDPSLDHSNK EYVAQKNGHL  300
PQKNAVPDGS IPISQSVHPP TLGPFKVTYR PLLADIVQEE DIKELCKLLV VVSGEAAKAY  360
AGRKTQEERD AEKEDEGGGQ KEDDKAGSRG STNHDREGNN QDPDHKASIN DNSSRGTHTG  420
KAVLEESRPN CADDQKSNRP MSPGTLALMC DEQDTMFTTS QNAAPQQTVA DNQNQSELYA  480
EQERVVLTEF RDCLRKLVTC GRMKEERYSM AIKSETSGHP GQVNGVSRVP YPRVDVPAVV  540
KTFPQGSSSH PVAGKPVTGH LDKN*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0672400.0BT067240.1 Zea mays full-length cDNA clone ZM_BFb0345D13 mRNA, complete cds.
GenBankHQ8586710.0HQ858671.1 Zea mays clone UT1107 CPP transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970041.10.0PREDICTED: protein tesmin/TSO1-like CXC 5 isoform X1
SwissprotQ9SZD11e-130TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLK3XFR10.0K3XFR1_SETIT; Uncharacterized protein
STRINGSi000730m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47303657
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-116Tesmin/TSO1-like CXC domain-containing protein